Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEW9
Confidence43.15%DateThu Jan 5 11:24:29 GMT 2012
Rank71Aligned Residues31
% Identity16%Templatec3d8xB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:thioredoxin reductase 1; PDBTitle: crystal structure of saccharomyces cerevisiae nadph dependent2 thioredoxin reductase 1
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........
Predicted Secondary structure 






















Query SS confidence 


























































Query Sequence  MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVG
Query Conservation 
   
  
  
  

                       

   


  
  

      
Alig confidence 









............................




















Template Conservation 
  






............................
 


 

  
   
  
 

Template Sequence  VHNKVTIIGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . GPAAHTAAIYLARAEIKPILY
Template Known Secondary structure 


............................STT


Template Predicted Secondary structure 





............................




Template SS confidence 


























































   2.......10. ........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions