Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEW9
Confidence13.90%DateThu Jan 5 11:24:29 GMT 2012
Rank97Aligned Residues32
% Identity25%Templatec2gr2A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:ferredoxin reductase; PDBTitle: crystal structure of ferredoxin reductase, bpha4 (oxidized form)
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50..... ....60
Predicted Secondary structure 






















..
Query SS confidence 






















































. .




Query Sequence  MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGID. . VTVGG
Query Conservation 
   
  
  
  

                       

   


  
  

  ..     
Alig confidence 









............................
















..




Template Conservation 

  





............................
 


 

  
   
    
 


Template Sequence  LKAPVVVLGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GLASVSFVAELRQAGYQGLITVVG
Template Known Secondary structure 

SS

............................ST

S
Template Predicted Secondary structure 





............................





Template SS confidence 





























































   6...10..... ....20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions