Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEW9
Confidence31.91%DateThu Jan 5 11:24:29 GMT 2012
Rank74Aligned Residues40
% Identity20%Templatec2dlnA_
PDB info PDB header:ligase(peptidoglycan synthesis)Chain: A: PDB Molecule:d-alanine--d-alanine ligase; PDBTitle: vancomycin resistance: structure of d-alanine:d-alanine2 ligase at 2.3 angstroms resolution
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........
Predicted Secondary structure 






















Query SS confidence 


























































Query Sequence  MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVG
Query Conservation 
   
  
  
  

                       

   


  
  

      
Alig confidence 





















...................

















Template Conservation 
  

 
  

   
  
 
 
...................   
  

   
  
  
Template Sequence  MTDKIAVLLGGTSAEREVSLNS. . . . . . . . . . . . . . . . . . . GAAVLAGLREGGIDAYPV
Template Known Secondary structure 

S


SSTT...................TT
Template Predicted Secondary structure 






...................


Template SS confidence 


























































   1........10.........20.. .......30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions