Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEW9
Confidence20.19%DateThu Jan 5 11:24:29 GMT 2012
Rank86Aligned Residues31
% Identity29%Templatec1v59B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:dihydrolipoamide dehydrogenase; PDBTitle: crystal structure of yeast lipoamide dehydrogenase2 complexed with nad+
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1... .....10.........20.........30.........40.........50.........
Predicted Secondary structure 


..



















Query SS confidence 



. .






















































Query Sequence  MSRR. . VATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVG
Query Conservation 
   ..
  
  
  

                       

   


  
  

      
Alig confidence 



..





............................




















Template Conservation 
   







............................
 


 

  
   
  
 

Template Sequence  INKSHDVVIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGYVAAIKAAQLGFNTACV
Template Known Secondary structure 

............................STT

Template Predicted Secondary structure 




............................



Template SS confidence 




























































   2.......10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions