Return to main results Retrieve Phyre Job Id

Job DescriptionP36661
Confidence13.55%DateThu Jan 5 11:53:33 GMT 2012
Rank23Aligned Residues53
% Identity28%Templatec3c0mB_
PDB info PDB header:toxinChain: B: PDB Molecule:aerolysin; PDBTitle: crystal structure of the proaerolysin mutant y221g
Resolution2.88 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   96...100.........110.........120.........130.........140.........150.........160........
Predicted Secondary structure 






























Query SS confidence 








































































Query Sequence  IYSGVSGGITYTIQYVRDIDIVRVSLPGRASESITDFKGYYWYNFMEYIENINACDDVFSEYCFDDENISVQP
Query Conservation 








































































Alig confidence 






























....................





















Template Conservation    
 


 
 
 

  
 
  
         ....................       
  

       
  
Template Sequence  VRAGITGDFSAESQFAGNIEIGAPVPLLRLE. . . . . . . . . . . . . . . . . . . . IPLDAQELSGLGFNNVSLSVTP
Template Known Secondary structure 








....................



TT
Template Predicted Secondary structure 












....................







Template SS confidence 








































































   396...400.........410.........420...... ...430.........440........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions