Return to main results Retrieve Phyre Job Id

Job DescriptionP36661
Confidence4.98%DateThu Jan 5 11:53:33 GMT 2012
Rank70Aligned Residues22
% Identity45%Templatec2kwrA_
PDB info PDB header:transferaseChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: solution nmr structure of the apoform of nare (nmb1343)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   368.370.........380.........390.......
Predicted Secondary structure 













Query SS confidence 





























Query Sequence  FSTDEDLEYGYLMNTGNHYDVYLPPELFAQ
Query Conservation 
 





 











 

 




Alig confidence 












........








Template Conservation 



 







........ 
   

  
Template Sequence  FATSSGIENGYIY. . . . . . . . VLNRDLFGQ
Template Known Secondary structure  TTTT........
Template Predicted Secondary structure 







........



Template SS confidence 





























   81........90... ......100..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions