Return to main results Retrieve Phyre Job Id

Job DescriptionP37002
Confidence1.13%DateThu Jan 5 11:54:13 GMT 2012
Rank96Aligned Residues36
% Identity19%Templatec2a6eF_
PDB info PDB header:transferaseChain: F: PDB Molecule:rna polymerase sigma factor rpod; PDBTitle: crystal structure of the t. thermophilus rna polymerase2 holoenzyme
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   48.50.........60.........70..... ....80...
Predicted Secondary structure 




..............
Query SS confidence 



























. . . . . . . . . . . . . .







Query Sequence  IGIGFAWFSRMTNIDPVWKVLITTGFCG. . . . . . . . . . . . . . GLTTFSTF
Query Conservation 

 
                 
  

 
.............. 






Alig confidence 



























..............







Template Conservation 



  




   

   





 











 

 





  
Template Sequence  LRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATW
Template Known Secondary structure  TTS
TTTS


TTS


Template Predicted Secondary structure 













Template SS confidence 

















































   192.......200.........210.........220.........230.........240.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions