Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADI4
Confidence22.59%DateThu Jan 5 11:21:04 GMT 2012
Rank134Aligned Residues32
% Identity19%Templatec2xexA_
PDB info PDB header:translationChain: A: PDB Molecule:elongation factor g; PDBTitle: crystal structure of staphylococcus aureus elongation factor2 g
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.........70.......
Predicted Secondary structure 















Query SS confidence 













































Query Sequence  ALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYT
Query Conservation 







  
             

  
  

  

  




 
Alig confidence 









..............





















Template Conservation 






 

..............
  

   
       

 


Template Sequence  AVTVLDAQSG. . . . . . . . . . . . . . VEPQTETVWRQATTYGVPRIVF
Template Known Secondary structure  TTTB..............S
TT

Template Predicted Secondary structure 



..............





Template SS confidence 













































   102.......110. ........120.........130...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions