Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADI4
Confidence25.36%DateThu Jan 5 11:21:04 GMT 2012
Rank126Aligned Residues34
% Identity15%Templatec1zn0B_
PDB info PDB header:translation/biosynthetic protein/rnaChain: B: PDB Molecule:elongation factor g; PDBTitle: coordinates of rrf and ef-g fitted into cryo-em map of the2 50s subunit bound with both ef-g (gdpnp) and rrf
Resolution15.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.......
Predicted Secondary structure 

















Query SS confidence 















































Query Sequence  RAALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYT
Query Conservation 









  
             

  
  

  

  




 
Alig confidence 











..............





















Template Conservation 








 

..............
  

  


      

 


Template Sequence  DGAIVVFDSSQG. . . . . . . . . . . . . . VEPQSETVWRQAEKYKVPRIAF
Template Known Secondary structure  S
STT
..............S
TT

Template Predicted Secondary structure 



..............




Template SS confidence 















































   102.......110... ......120.........130.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions