Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB77
Confidence23.13%DateThu Jan 5 11:14:48 GMT 2012
Rank375Aligned Residues41
% Identity20%Templatec2ejbA_
PDB info PDB header:lyaseChain: A: PDB Molecule:probable aromatic acid decarboxylase; PDBTitle: crystal structure of phenylacrylic acid decarboxylase from2 aquifex aeolicus
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   342.......350.........360.........370.........380...... ...390......
Predicted Secondary structure 

















.


Query SS confidence 












































.









Query Sequence  ARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEA. FTRIGKQLGV
Query Conservation     
   

 
              


      
 



 
   .
  
   

 
Alig confidence 












..............

















.









Template Conservation     
   
  
 
..............     
  
  
   
  

 
 

  

Template Sequence  MLKITRMGGVVVP. . . . . . . . . . . . . . ASPAFYHKPQSIDDMINFVVGKLLDVLRI
Template Known Secondary structure  TT
..............



STT


STT
Template Predicted Secondary structure 



..............









Template SS confidence 























































   138.140.........150 .........160.........170.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions