Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB77
Confidence83.12%DateThu Jan 5 11:14:48 GMT 2012
Rank240Aligned Residues42
% Identity24%Templatec1qysA_
PDB info PDB header:de novo proteinChain: A: PDB Molecule:top7; PDBTitle: crystal structure of top7: a computationally designed2 protein with a novel fold
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   339340.........350.........360.........370.........380.........390.....
Predicted Secondary structure 



















Query SS confidence 
























































Query Sequence  QKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLG
Query Conservation    
   
   

 
              


      
 



 
   
  
   

Alig confidence 










..............










.



















Template Conservation   

   
 
 
..............

 
 




 .    
     

 
    

Template Sequence  NELXDYIKKQG. . . . . . . . . . . . . . AKRVRISITAR. TKKEAEKFAAILIKVFAELG
Template Known Secondary structure 
..............
S
S.STT
Template Predicted Secondary structure 

..............


.


Template SS confidence 
























































   34.....40.... .....50..... ....60.........70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions