Return to main results Retrieve Phyre Job Id

Job DescriptionP0A991
Confidence27.12%DateThu Jan 5 11:09:38 GMT 2012
Rank465Aligned Residues61
% Identity10%Templatec3qvqB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:phosphodiesterase olei02445; PDBTitle: the structure of an oleispira antarctica phosphodiesterase olei024452 in complex with the product sn-glycerol-3-phosphate
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   153......160.........170.........180.........190.........200.........210.........220.........230..
Predicted Secondary structure 




























Query SS confidence 















































































Query Sequence  VEQAFNMGAVAVGATIYFGSEESRRQIEEISAAFERAHELGMVTVLWAYLRNSAFKKDGVDYHVSADLTGQANHLAATIG
Query Conservation 













 

 


 
  

 


 




   





  



  
     
 
 





 








Alig confidence 




















..........















......




............









Template Conservation                       ..........  
      
  
  
......


  ............     
   
Template Sequence  QERLEHLDCAGLHIHQSFFDV. . . . . . . . . . QQVSDIKAAGYKVLAF. . . . . . TINDE. . . . . . . . . . . . SLALKLYNQG
Template Known Secondary structure  T
SGGG

..........TT
......



............TT
Template Predicted Secondary structure 






..........


......



............

Template SS confidence 















































































   179180.........190......... 200.........210..... ....220 .........230
 
   233......240.
Predicted Secondary structure 



Query SS confidence 








Query Sequence  ADIVKQKMA
Query Conservation 





 

Alig confidence 








Template Conservation 



 

 
Template Sequence  LDAVFSDYP
Template Known Secondary structure 

SS
Template Predicted Secondary structure 



Template SS confidence 








   231........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions