Return to main results Retrieve Phyre Job Id

Job DescriptionP0A991
Confidence28.04%DateThu Jan 5 11:09:38 GMT 2012
Rank458Aligned Residues40
% Identity13%Templatec3no3A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:glycerophosphodiester phosphodiesterase; PDBTitle: crystal structure of a glycerophosphodiester phosphodiesterase2 (bdi_0402) from parabacteroides distasonis atcc 8503 at 1.89 a3 resolution
Resolution1.89 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   184.....190.........200.........210.........220.........230.........240.
Predicted Secondary structure 
























Query SS confidence 

























































Query Sequence  AAFERAHELGMVTVLWAYLRNSAFKKDGVDYHVSADLTGQANHLAATIGADIVKQKMA
Query Conservation   




   





  



  
     
 
 





 














 

Alig confidence 















......




............


















Template Conservation    
      
  
  
......


  ............         


 
 

 
Template Sequence  DWVKDCKVLGXTSNVW. . . . . . TVDDP. . . . . . . . . . . . KLXEEXIDXGVDFITTDLP
Template Known Secondary structure  TTT
......


S............T
SS
Template Predicted Secondary structure 


......


............






Template SS confidence 

























































   207..210.........220.. ..... ..230.........240......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions