Return to main results Retrieve Phyre Job Id

Job DescriptionP0A991
Confidence49.39%DateThu Jan 5 11:09:38 GMT 2012
Rank400Aligned Residues35
% Identity31%Templatec2duwA_
PDB info PDB header:ligand binding proteinChain: A: PDB Molecule:putative coa-binding protein; PDBTitle: solution structure of putative coa-binding protein of2 klebsiella pneumoniae
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   153......160.........170.........180.........190.......
Predicted Secondary structure 











Query SS confidence 












































Query Sequence  VEQAFNMGAVAVGATIYFGSEESRRQIEEISAAFERAHELGMVTV
Query Conservation 













 

 


 
  

 


 




   




Alig confidence 











..








........













Template Conservation 
 
    
   
..    
    ........
    
   

 

Template Sequence  AQEAIAIGAKTL. . WLQLGVINE. . . . . . . . QAAVLAREAGLSVV
Template Known Secondary structure  T

..

TT


........TTT
Template Predicted Secondary structure 



..





........


Template SS confidence 












































   87..90........ .100....... ..110.........120.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions