Return to main results Retrieve Phyre Job Id

Job DescriptionP52636
Confidence13.34%DateThu Jan 5 12:05:55 GMT 2012
Rank83Aligned Residues27
% Identity33%Templatec2b5lC_
PDB info PDB header:protein binding/viral proteinChain: C: PDB Molecule:nonstructural protein v; PDBTitle: crystal structure of ddb1 in complex with simian virus 5 v2 protein
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   222.......230.........240.........250.........260.
Predicted Secondary structure 






















Query SS confidence 







































Query Sequence  WCRYLCPYGALMGVVSLLSPFKIRRNAESCIDCGKCAKNC
Query Conservation 






 


 

    
   
  
   
  
  
   
Alig confidence 





............











.








Template Conservation 



 
............
 
    

  
. 
  

  
Template Sequence  WCNPSC. . . . . . . . . . . . SPITAAARRFEC. TCHQCPVTC
Template Known Secondary structure  SS............S


SS


.SSSS

S

Template Predicted Secondary structure 




............



.



Template SS confidence 







































   189190.... .....200...... ...210.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions