Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAS0
Confidence18.52%DateThu Jan 5 11:13:38 GMT 2012
Rank20Aligned Residues38
% Identity29%Templatec3hgtA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:hda1 complex subunit 3; PDBTitle: structural and functional studies of the yeast class ii hda12 hdac complex
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.. .......20.........30... .....
Predicted Secondary structure 
......






..........

Query SS confidence 











. . . . . .




















. . . . . . . . . .




Query Sequence  MTEIQRLLTETI. . . . . . ESLNTREKRDNKPRFSISFIR. . . . . . . . . . KHPGL
Query Conservation 
 


 

   
......  

  



 




  

 .......... 

 
Alig confidence 











......




















..........




Template Conservation 

  

 
   


     
 
               
   
  

 




 
Template Sequence  MSLYQKELTDQIVSLHYSDILRYFETSHYKEDVILESMKTMCLNGSLVATHPYL
Template Known Secondary structure 

TTTTT


GGG
Template Predicted Secondary structure 












Template SS confidence 





















































   37..40.........50.........60.........70.........80.........90
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions