Return to main results Retrieve Phyre Job Id

Job DescriptionP18390
Confidence1.97%DateThu Jan 5 11:36:53 GMT 2012
Rank70Aligned Residues35
% Identity23%Templatec3c1dA_
PDB info PDB header:recombination, dna binding proteinChain: A: PDB Molecule:regulatory protein recx; PDBTitle: x-ray crystal structure of recx
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   74.....80......... 90.........100.........
Predicted Secondary structure 

...............








Query SS confidence 















. . . . . . . . . . . . . . .



















Query Sequence  NAAGILQYCAKQKLAS. . . . . . . . . . . . . . . VTDAENIKNQVLEKLGLNSE
Query Conservation 
 



 







 ...............   
 

   
  


    
Alig confidence 















...............













.




Template Conservation   

 

  
 
 
 


  

            
   
   
  
.

   
Template Sequence  DYERVIAWCHEHGYLDDSRFVARFIASRSRKGYGPARIRQELNQK. GISRE
Template Known Secondary structure  TTS

TT

T.T

Template Predicted Secondary structure 









.


Template SS confidence 


















































   55....60.........70.........80.........90......... 100....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions