Return to main results Retrieve Phyre Job Id

Job DescriptionP0C8K0
Confidence31.82%DateThu Jan 5 11:30:07 GMT 2012
Rank92Aligned Residues37
% Identity27%Templatec3h7uA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:aldo-keto reductase; PDBTitle: crystal structure of the plant stress-response enzyme akr4c9
Resolution1.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100.........110.........120.........
Predicted Secondary structure 



















Query SS confidence 


















































Query Sequence  NFPQDALILGGDHLGPNRWQNLPAAQAMANADDLIKSYVAAGFKKIHLDCS
Query Conservation        
 







  

 
   


  

 

   
 


  



 
Alig confidence 















............















..




Template Conservation 
  

 




     ............      
  
   

 .. 



Template Sequence  GAKFPSVGLGTWQASP. . . . . . . . . . . . GLVGDAVAAAVKIGYR. . HIDCA
Template Known Secondary structure  S
SB

TT

............T

..

Template Predicted Secondary structure 







............



..

Template SS confidence 


















































   13......20........ .30.........40.... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions