Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACW6
Confidence19.37%DateThu Jan 5 11:19:17 GMT 2012
Rank13Aligned Residues28
% Identity39%Templatec3he5A_
PDB info PDB header:de novo proteinChain: A: PDB Molecule:synzip1; PDBTitle: heterospecific coiled-coil pair synzip2:synzip1
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40.........50.........60...
Predicted Secondary structure 






Query SS confidence 



































Query Sequence  KLDHEIARKEGSDGRGYNAEVVRMKKQKLQLKDEML
Query Conservation   

  
  

       
   
 





 





Alig confidence 










........
















Template Conservation 










........
















Template Sequence  QLENEVASLEN. . . . . . . . ENETLKKKNLHKKDLIA
Template Known Secondary structure  ........
Template Predicted Secondary structure  ........


Template SS confidence 



































   5....10..... ....20.........30..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions