Return to main results Retrieve Phyre Job Id

Job DescriptionP76057
Confidence2.13%DateThu Jan 5 12:17:58 GMT 2012
Rank60Aligned Residues30
% Identity23%Templatec3cxjB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of an uncharacterized protein from2 methanothermobacter thermautotrophicus
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40........
Predicted Secondary structure 












Query SS confidence 








































Query Sequence  EEWMVEYGLMLRTGLGARQIEAYRQNCWVEGFHFKRVSPLG
Query Conservation 








































Alig confidence 

















...........











Template Conservation 
 

 


       


...........  

 
   
  
Template Sequence  KKWLDEEGFLRXEVPDEN. . . . . . . . . . . ARFHYVVNYPED
Template Known Secondary structure  T




TT...........
STT
Template Predicted Secondary structure 







...........




Template SS confidence 








































   910.........20...... ...30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions