Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8D9
Confidence2.27%DateThu Jan 5 11:07:35 GMT 2012
Rank96Aligned Residues32
% Identity22%Templated2o9xa1
SCOP infoTorD-like TorD-like TorD-like
Resolution3.40

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   102.......110.........120.........130.........140..
Predicted Secondary structure 












Query SS confidence 








































Query Sequence  ILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQ
Query Conservation 
  

 

  

  

        

 
 


 

  

  
Alig confidence 













.........

















Template Conservation 
  
   
   
  .........   

  

 

  



Template Sequence  FRDWFLEFAKCVEE. . . . . . . . . KSEIYATFARAFRKFLEK
Template Known Secondary structure  TT.........

Template Predicted Secondary structure  .........



Template SS confidence 








































   122.......130..... ....140.........150...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions