Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8D9
Confidence2.54%DateThu Jan 5 11:07:35 GMT 2012
Rank84Aligned Residues28
% Identity29%Templated1cf7b_
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain Cell cycle transcription factor e2f-dp
Resolution2.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   101........110.........120.........130......
Predicted Secondary structure 












Query SS confidence 



































Query Sequence  AILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTL
Query Conservation   
  

 

  

  

        

 
 


 

Alig confidence 


















........








Template Conservation 


  
 



 
  
  
........

 





Template Sequence  GLRHFSMKVCEKVQRKGTT. . . . . . . . SYNEVADEL
Template Known Secondary structure  S........
Template Predicted Secondary structure 



........
Template SS confidence 



































   70.........80........ .90.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions