Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8D9
Confidence12.35%DateThu Jan 5 11:07:35 GMT 2012
Rank9Aligned Residues40
% Identity13%Templatec3sibA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:ure3-bp sequence specific dna binding protein; PDBTitle: crystal structure of ure3-binding protein, wild-type
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   92.......100... ......110.........120.........130.........140......
Predicted Secondary structure 




.












Query SS confidence 











.










































Query Sequence  KRSVTPLPPAIL. NWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKT
Query Conservation 


 
 


 
 . 

 

  

  

        

 
 


 

  

  

  
Alig confidence 











.
















...............










Template Conservation 
                 
   

  
  
...............
   
   
 
Template Sequence  WNLQPIMPPSVRNTWWFPLLNTIPLDQYTR. . . . . . . . . . . . . . . IYQWFMGVDRD
Template Known Secondary structure  T






TSTTGGGGGG

...............
TT
Template Predicted Secondary structure 














...............


Template SS confidence 























































   11........20.........30.........40 .........50.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions