Return to main results Retrieve Phyre Job Id

Job DescriptionP42603
Confidence2.36%DateThu Jan 5 12:01:47 GMT 2012
Rank41Aligned Residues33
% Identity21%Templated3cuma1
SCOP info6-phosphogluconate dehydrogenase C-terminal domain-like 6-phosphogluconate dehydrogenase C-terminal domain-like Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   125....130.........140.........150.........160.........
Predicted Secondary structure 



Query SS confidence 












































Query Sequence  STCCWVIHNFWAGSIGGTMIEGSFLLMNGLNIIRFWRMQKRGIDP
Query Conservation   
  

  
  


  
 
 
    
 
  

 

 
    
   
Alig confidence 
























............







Template Conservation 
   

  
 
        



 
............
   


 
Template Sequence  GQVAKVCNNQLLAVLXIGTAEAXAL. . . . . . . . . . . . GVANGLEA
Template Known Secondary structure  ............TT

Template Predicted Secondary structure  ............



Template SS confidence 












































   167..170.........180.........190. ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions