Return to main results Retrieve Phyre Job Id

Job DescriptionP69490
Confidence63.20%DateThu Jan 5 12:11:44 GMT 2012
Rank23Aligned Residues43
% Identity30%Templatec3e0dA_
PDB info PDB header:transferase/dnaChain: A: PDB Molecule:dna polymerase iii subunit alpha; PDBTitle: insights into the replisome from the crystral structure of2 the ternary complex of the eubacterial dna polymerase iii3 alpha-subunit
Resolution4.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.........100.........110.......
Predicted Secondary structure 

























Query SS confidence 






























































Query Sequence  EVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDAEGSVDVSYEGILPDLFREGQGVVVQGELEK
Query Conservation    
  




 
  


        
 
 


    
 
 
 
  

 
 

  


 
    
Alig confidence 













...........














.........













Template Conservation       
 
 
 
  ........... 
 



 

  


.........       
 
 
  
Template Sequence  PGKPKVLLSGMVEE. . . . . . . . . . . VRFTLSDETGALEVV. . . . . . . . . KEDIPLLVLAEVER
Template Known Secondary structure  SSS


...........

TT
.........
TT


Template Predicted Secondary structure 



...........

.........


Template SS confidence 






























































   1040.........1050... ......1060........ .1070.........1080..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions