Return to main results Retrieve Phyre Job Id

Job DescriptionP69490
Confidence6.42%DateThu Jan 5 12:11:44 GMT 2012
Rank99Aligned Residues28
% Identity21%Templatec1jpeA_
PDB info PDB header:electron transportChain: A: PDB Molecule:dsbd-alpha; PDBTitle: crystal structure of dsbd-alpha; the n-terminal domain of2 dsbd
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.........70.........80.......
Predicted Secondary structure 

























Query SS confidence 


















































Query Sequence  FYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGSVQRDPNSLKVTFTIYDA
Query Conservation 
 



              
  




 
  


        
 
 


 
Alig confidence 






................


.......

















Template Conservation 


  

................
  .......        
 
   

 
Template Sequence  FVPADQA. . . . . . . . . . . . . . . . FAF. . . . . . . DFQQNQHDLNLTWQIKDG
Template Known Secondary structure 


.......................TT
TT
Template Predicted Secondary structure 


.......................




Template SS confidence 


















































   11...... ..20 .........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions