Return to main results Retrieve Phyre Job Id

Job DescriptionP15286
Confidence7.76%DateThu Jan 5 11:34:44 GMT 2012
Rank90Aligned Residues28
% Identity39%Templatec3l3fX_
PDB info PDB header:protein bindingChain: X: PDB Molecule:protein doa1; PDBTitle: crystal structure of a pfu-pul domain pair of saccharomyces cerevisiae2 doa1/ufd3
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   76...80.........90.........100.........110.........120...
Predicted Secondary structure 





Query SS confidence 















































Query Sequence  FPAAEHNLAQRLLAAQKSHSARQLLAQLGEYLRLGNNRQAVTDYIRHN
Query Conservation 
  


 

  
  

   
 
 

  
      






  
   
Alig confidence 









...................





.











Template Conservation    

  

  ...................
 
   .





 

  
Template Sequence  YTAADNFLAR. . . . . . . . . . . . . . . . . . . YELPXS. YRDQVVQFILKN
Template Known Secondary structure  ...................TT

GG.G
Template Predicted Secondary structure  ...................


.
Template SS confidence 















































   411........420 ...... ...430........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions