Return to main results Retrieve Phyre Job Id

Job DescriptionP15286
Confidence10.37%DateThu Jan 5 11:34:44 GMT 2012
Rank62Aligned Residues34
% Identity29%Templatec2z3xC_
PDB info PDB header:dna binding protein/dnaChain: C: PDB Molecule:small, acid-soluble spore protein c; PDBTitle: structure of a protein-dna complex essential for dna2 protection in spore of bacillus species
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   162.......170.........180.........190.........200.........210
Predicted Secondary structure 















Query SS confidence 
















































Query Sequence  RPLLPAEHNALKQLVTKLAAATGEPSKQIWQSMLELSGVKDGELIPAKL
Query Conservation 


 


   




  

  


    


 
    



 
 


 
Alig confidence 




















...............












Template Conservation 
 


 
  

   
 


 
...............


    
 


 
Template Sequence  KLLIPQAASAIEQMKLEIASE. . . . . . . . . . . . . . . FGVQLGAETTSRA
Template Known Secondary structure 

SSGGG...............T


STTS
Template Predicted Secondary structure 



...............








Template SS confidence 
















































   3......10.........20... ......30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions