Return to main results Retrieve Phyre Job Id

Job DescriptionP77318
Confidence30.78%DateThu Jan 5 12:27:41 GMT 2012
Rank41Aligned Residues38
% Identity34%Templated1v82a_
SCOP infoNucleotide-diphospho-sugar transferases Nucleotide-diphospho-sugar transferases 1,3-glucuronyltransferase
Resolution1.85

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80.........90.........100.........110.. .......120.........130..
Predicted Secondary structure 














































.







Query SS confidence 






















































.



















Query Sequence  PNIIVLTMDDLGYGQLPFDKGSFDPKTMENREVVDTYKIGIDKAIEAAQKSTPTL. LSLMDEGVRFTNGYVAHGVS
Query Conservation 



 
  

 
       
                             
 



.
 

  

 
 
 
     
Alig confidence 











.....................................





.



















Template Conservation 
 
 






 .....................................  
  
  

  


 
 

    
  
Template Sequence  PNLHWLVVEDAP. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RRTPLTARLLRDTGLNYTHLHVETPRN
Template Known Secondary structure  SSSSS.....................................S







Template Predicted Secondary structure 





.....................................










Template SS confidence 











































































   113......120.... .....130.........140.........150.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions