Return to main results Retrieve Phyre Job Id

Job DescriptionP77318
Confidence8.60%DateThu Jan 5 12:27:41 GMT 2012
Rank73Aligned Residues26
% Identity50%Templatec3tixB_
PDB info PDB header:gene regulation/protein bindingChain: B: PDB Molecule:chromo domain-containing protein 1; PDBTitle: crystal structure of the chp1-tas3 complex core
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   338.340.........350.........360......... 370........
Predicted Secondary structure 

























..

Query SS confidence 































. .








Query Sequence  TIILFTSDNGAVIDGPLPLNGAQKGYKSQTYP. . GGTHTPMFM
Query Conservation 









                
    
..   





Alig confidence 











...............




..








Template Conservation 


 

 

  
...............

 
 
     



 
Template Sequence  TLLLFTEDNNAL. . . . . . . . . . . . . . . MNLYDCQGQSNSPFWM
Template Known Secondary structure  TT
...............TT

S


SS
Template Predicted Secondary structure 



...............







Template SS confidence 










































   618.620......... 630.........640.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions