Return to main results Retrieve Phyre Job Id

Job DescriptionP77318
Confidence33.43%DateThu Jan 5 12:27:41 GMT 2012
Rank39Aligned Residues42
% Identity24%Templatec2d0jD_
PDB info PDB header:transferaseChain: D: PDB Molecule:galactosylgalactosylxylosylprotein 3-beta- PDBTitle: crystal structure of human glcat-s apo form
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80.........90.........100.........110.... .....120.........130......
Predicted Secondary structure 














































.







Query SS confidence 
























































.





















Query Sequence  PNIIVLTMDDLGYGQLPFDKGSFDPKTMENREVVDTYKIGIDKAIEAAQKSTPTLLS. LMDEGVRFTNGYVAHGVSGPSR
Query Conservation 



 
  

 
       
                             
 




 .

  

 
 
 
     
 


Alig confidence 











.....................................







.





















Template Conservation 
 
 





  .....................................  
  
  

  


 
 

    
     
Template Sequence  AQLHWILVEDAA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ARSELVSRFLARAGLPSTHLHVPTPRRGLPR
Template Known Secondary structure  TTSSS.....................................S


S









S
Template Predicted Secondary structure 




.....................................















Template SS confidence 















































































   109110.........120 .........130.........140.........150.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions