Return to main results Retrieve Phyre Job Id

Job DescriptionP08372
Confidence3.36%DateThu Jan 5 11:01:22 GMT 2012
Rank82Aligned Residues25
% Identity20%Templatec2f9jP_
PDB info PDB header:rna binding proteinChain: P: PDB Molecule:splicing factor 3b subunit 1; PDBTitle: 3.0 angstrom resolution structure of a y22m mutant of the spliceosomal2 protein p14 bound to a region of sf3b155
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.. .......70.
Predicted Secondary structure 
........






Query SS confidence 















. . . . . . . .








Query Sequence  YQQLWRHGWQQTQLRA. . . . . . . . ISPPANWQV
Query Conservation    

 


 
 

   ........   
 

  
Alig confidence 















........








Template Conservation 
 
  
  

  













 
 



Template Sequence  QLQAWRWEREIDERNRPLSDEELDAMFPEGYKV
Template Known Secondary structure  TTS


TTS
SS


Template Predicted Secondary structure 











Template SS confidence 
































   382.......390.........400.........410....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions