Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7N4
Confidence44.41%DateThu Jan 5 11:05:59 GMT 2012
Rank26Aligned Residues20
% Identity20%Templatec2qkdA_
PDB info PDB header:signaling protein, cell cycleChain: A: PDB Molecule:zinc finger protein zpr1; PDBTitle: crystal structure of tandem zpr1 domains
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2930..... ....40..... ...
Predicted Secondary structure 




................






.


Query SS confidence 






. . . . . . . . . . . . . . . .









.


Query Sequence  SVDKTSG. . . . . . . . . . . . . . . . EKHLRHHITA. DGY
Query Conservation    
  

................     
 

 . 
 
Alig confidence 






................









.


Template Conservation 


  

  
 

 
   



 



 

 
  


Template Sequence  SLCMNCYRNGTTRLLLTKIPFFREIIVSSFSCEHCGW
Template Known Secondary structure 
TTTSSTTT
TTT

Template Predicted Secondary structure 






















Template SS confidence 




































   4950.........60.........70.........80.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions