Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7N4
Confidence64.50%DateThu Jan 5 11:05:59 GMT 2012
Rank14Aligned Residues24
% Identity17%Templatec1i3qI_
PDB info PDB header:transcriptionChain: I: PDB Molecule:dna-directed rna polymerase ii 14.2kd PDBTitle: rna polymerase ii crystal form i at 3.1 a resolution
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40 ..... ...
Predicted Secondary structure 












.........

.


Query SS confidence 















. . . . . . . . .




.


Query Sequence  VTSLSVDKTSGEKHLR. . . . . . . . . HHITA. DGY
Query Conservation   
 
  
  

     .........
 

 . 
 
Alig confidence 















.........




.


Template Conservation     
 


 




              
  
  
Template Sequence  MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSY
Template Known Secondary structure 




B
SSS

BTTTTSSS

Template Predicted Secondary structure 






















Template SS confidence 

































   1........10.........20.........30....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions