Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAT2
Confidence7.87%DateThu Jan 5 11:13:45 GMT 2012
Rank18Aligned Residues28
% Identity7%Templated1igna1
SCOP infoDNA/RNA-binding 3-helical bundle Homeodomain-like DNA-binding domain of rap1
Resolution2.25

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   93......100.. .......110.........120
Predicted Secondary structure  .........




Query SS confidence 









. . . . . . . . .

















Query Sequence  EALLRDLIND. . . . . . . . . SWNLVVDGLAKRDQKRVR
Query Conservation     
  

  .........

 

  



     
 
Alig confidence 









.........

















Template Conservation 
  
   
            
  

  

 

  


Template Sequence  DEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIR
Template Known Secondary structure  TSGGGTT
STTTSTTS
Template Predicted Secondary structure 












Template SS confidence 




































   368.370.........380.........390.........400....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions