Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6X7
Confidence42.01%DateThu Jan 5 11:04:10 GMT 2012
Rank20Aligned Residues31
% Identity23%Templated1qb2a_
SCOP infoSignal peptide-binding domain Signal peptide-binding domain Signal peptide-binding domain
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2...... .10.........20.........30..
Predicted Secondary structure 


...............


Query SS confidence 






. . . . . . . . . . . . . . .























Query Sequence  ALTKAEM. . . . . . . . . . . . . . . SEYLFDKLGLSKRDAKELVELFFE
Query Conservation 



 

...............
  

     
   
   
  
  
Alig confidence 






...............























Template Conservation 


  

  
   
      

  


 


    


 



   
Template Sequence  SMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTK
Template Known Secondary structure  TS
STTTSTTT

Template Predicted Secondary structure 











Template SS confidence 













































   381........390.........400.........410.........420......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions