Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6X7
Confidence10.61%DateThu Jan 5 11:04:10 GMT 2012
Rank70Aligned Residues31
% Identity29%Templatec3dm5A_
PDB info PDB header:rna binding protein, transport proteinChain: A: PDB Molecule:signal recognition 54 kda protein; PDBTitle: structures of srp54 and srp19, the two proteins assembling2 the ribonucleic core of the signal recognition particle3 from the archaeon pyrococcus furiosus.
Resolution2.51 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10 .........20.........30..
Predicted Secondary structure 


..........


Query SS confidence 








. . . . . . . . . .





















Query Sequence  ALTKAEMSE. . . . . . . . . . YLFDKLGLSKRDAKELVELFFE
Query Conservation 



 


 .......... 

     
   
   
  
  
Alig confidence 








..........





















Template Conservation 


  
   
     

  


 


     
  

     
Template Sequence  SMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQ
Template Known Secondary structure  TS

GGG

TS
Template Predicted Secondary structure 











Template SS confidence 








































   381........390.........400.........410.........420.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions