Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6X7
Confidence7.64%DateThu Jan 5 11:04:10 GMT 2012
Rank87Aligned Residues31
% Identity29%Templatec2j37W_
PDB info PDB header:ribosomeChain: W: PDB Molecule:signal recognition particle 54 kda protein PDBTitle: model of mammalian srp bound to 80s rncs
Resolution8.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2....... 10.........20.........30..
Predicted Secondary structure 


...............


Query SS confidence 







. . . . . . . . . . . . . . .






















Query Sequence  ALTKAEMS. . . . . . . . . . . . . . . EYLFDKLGLSKRDAKELVELFFE
Query Conservation 



 


...............  

     
   
   
  
  
Alig confidence 







...............






















Template Conservation 


  
   
          

  


 


     
  

     
Template Sequence  SMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTK
Template Known Secondary structure  TS

TT
TTT

Template Predicted Secondary structure 














Template SS confidence 













































   381........390.........400.........410.........420......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions