Return to main results Retrieve Phyre Job Id

Job DescriptionP32688
Confidence15.28%DateThu Jan 5 11:50:12 GMT 2012
Rank57Aligned Residues28
% Identity36%Templatec3j09A_
PDB info PDB header:hydrolase, metal transportChain: A: PDB Molecule:copper-exporting p-type atpase a; PDBTitle: high resolution helical reconstruction of the bacterial p-type atpase2 copper transporter copa
Resolution10.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   182.......190.........200.........210.......
Predicted Secondary structure 























Query SS confidence 



































Query Sequence  RSYAWVVYPDGRTQKAPVAYWNKRHVEPMPGSIIYV
Query Conservation     
 

 


 
     
 

       

  
 
Alig confidence 







.









.......









Template Conservation       
 
. 
    
   ....... 
  



 
Template Sequence  AKTAVVIR. DGKEIAVPVE. . . . . . . EVAVGDIVIV
Template Known Secondary structure 
S.TTGG.......G

TT
Template Predicted Secondary structure 

.



.......





Template SS confidence 



































   224.....230. ........240. ........250.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions