Return to main results Retrieve Phyre Job Id

Job DescriptionP75829
Confidence18.83%DateThu Jan 5 12:14:45 GMT 2012
Rank12Aligned Residues30
% Identity33%Templatec3qu3A_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:interferon regulatory factor 7; PDBTitle: crystal structure of irf-7 dbd apo form
Resolution1.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50..... ....60.....
Predicted Secondary structure 










..........
Query SS confidence 



















. . . . . . . . . .









Query Sequence  LSLARGQCRPGKFWHRRSFR. . . . . . . . . . QKFLLRSLIM
Query Conservation    
  
       
     
.......... 




 

 
Alig confidence 



















..........









Template Conservation 

  


              
 
  

  









Template Sequence  WAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALH
Template Known Secondary structure  TTSS
TT


S
TT
Template Predicted Secondary structure 






















Template SS confidence 







































   61........70.........80.........90.........100
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions