Return to main results Retrieve Phyre Job Id

Job DescriptionP75829
Confidence6.76%DateThu Jan 5 12:14:45 GMT 2012
Rank65Aligned Residues35
% Identity20%Templatec3dwdB_
PDB info PDB header:transport proteinChain: B: PDB Molecule:adp-ribosylation factor gtpase-activating protein 1; PDBTitle: crystal structure of the arfgap domain of human arfgap1
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   272.......280.........290.........300.........310.......
Predicted Secondary structure 
















Query SS confidence 













































Query Sequence  NAFWESVGGVCDAERHYRLPAQIARKEIAEIASKKRAEYRRRYEML
Query Conservation 
 

 
 

       
 


   

 



 




 




 

Alig confidence 





...........




























Template Conservation 
   
 ...........            

 
     

 

   
Template Sequence  REFLES. . . . . . . . . . . QEDYDPCWSLQEKYNSRAAALFRDKVVAL
Template Known Secondary structure  T...........STT

TT

TS
Template Predicted Secondary structure  ...........









Template SS confidence 













































   84..... 90.........100.........110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions