Return to main results Retrieve Phyre Job Id

Job DescriptionP39407
Confidence23.37%DateThu Jan 5 12:00:43 GMT 2012
Rank118Aligned Residues29
% Identity28%Templatec3dcjA_
PDB info PDB header:transferaseChain: A: PDB Molecule:probable 5'-phosphoribosylglycinamide PDBTitle: crystal structure of glycinamide formyltransferase (purn)2 from mycobacterium tuberculosis in complex with 5-methyl-5,3 6,7,8-tetrahydrofolic acid derivative
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40........
Predicted Secondary structure 









Query SS confidence 



































Query Sequence  APLSLRPFQPGRIALVCEGGGQRGIFTAGVLDEFMR
Query Conservation        
    





 


 

   



 

 
Alig confidence 





















.......






Template Conservation     
     
 

 

 

 

....... 
 


 
Template Sequence  EPLRVPPSAPARLVVLASGTGS. . . . . . . LLRSLLD
Template Known Secondary structure 




SS
SS

.......
Template Predicted Secondary structure 













.......
Template SS confidence 



































   3......10.........20.... .....30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions