Return to main results Retrieve Phyre Job Id

Job DescriptionP77489
Confidence53.25%DateThu Jan 5 12:29:50 GMT 2012
Rank44Aligned Residues41
% Identity27%Templated2fmra_
SCOP infoEukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   67..70.........80.........90.........100.........110.........120.........130.
Predicted Secondary structure 





























Query SS confidence 
































































Query Sequence  DTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPTIEHYHQAIALVVAETFEQARAAASLVQ
Query Conservation 
 
 
   


 



  
              
    

  




 


     
  
   
 
Alig confidence 





















........................


















Template Conservation 


 

 



  
 

     ........................
 
 


 


  

  

Template Sequence  NIQQARKVPGVTAIDLDEDTCT. . . . . . . . . . . . . . . . . . . . . . . . FHIYGEDQDAVKKARSFLE
Template Known Secondary structure  STTTTTT........................S

Template Predicted Secondary structure 







........................



Template SS confidence 
































































   25....30.........40...... ...50.........60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions