Return to main results Retrieve Phyre Job Id

Job DescriptionP77489
Confidence51.28%DateThu Jan 5 12:29:50 GMT 2012
Rank47Aligned Residues48
% Identity23%Templated2cpqa1
SCOP infoEukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   67..70.........80.........90.........100.........110.........120.........130........
Predicted Secondary structure 
































Query SS confidence 







































































Query Sequence  DTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPTIEHYHQAIALVVAETFEQARAAASLVQAHYRRNK
Query Conservation 
 
 
   


 



  
              
    

  




 


     
  
   
 



 
 
Alig confidence 





















........................

























Template Conservation 


 

 



  
 


 
  ........................
 
 


 


  

  

  

   
Template Sequence  NIQQARKVPGVTAIELDEDTGT. . . . . . . . . . . . . . . . . . . . . . . . FRIYGESADAVKKARGFLEFVEDFIQ
Template Known Secondary structure  TSTTTTTT........................SSS






Template Predicted Secondary structure 








........................

Template SS confidence 







































































   240.........250.........260. ........270.........280.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions