Return to main results Retrieve Phyre Job Id

Job DescriptionP32717
Confidence32.56%DateThu Jan 5 11:50:40 GMT 2012
Rank207Aligned Residues36
% Identity22%Templatec3klnC_
PDB info PDB header:transcriptionChain: C: PDB Molecule:transcriptional regulator, luxr family; PDBTitle: vibrio cholerae vpst
Resolution3.08 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   382.......390.........400.........410.........420.........
Predicted Secondary structure 



















Query SS confidence 















































Query Sequence  QTLHLANQGYTMNEIGDMIKLPPALANNWASRGYYGSVSHNARAVYNF
Query Conservation 



 

 
 
  

   
 

  

     
 




   




  
Alig confidence 






















............












Template Conservation   

  
  
 
   

  
 

 ............ 

  

  
  
Template Sequence  QIIKLLGSGASNIEIADKLFVSE. . . . . . . . . . . . NTVKTHLHNVFKK
Template Known Secondary structure  TT

TTTT

............
Template Predicted Secondary structure 





............
Template SS confidence 















































   165....170.........180....... ..190.........200
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions