Return to main results Retrieve Phyre Job Id

Job DescriptionP32717
Confidence69.47%DateThu Jan 5 11:50:40 GMT 2012
Rank150Aligned Residues36
% Identity22%Templatec1zljE_
PDB info PDB header:transcriptionChain: E: PDB Molecule:dormancy survival regulator; PDBTitle: crystal structure of the mycobacterium tuberculosis hypoxic2 response regulator dosr c-terminal domain
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   382.......390.........400.........410.........420.........
Predicted Secondary structure 



















Query SS confidence 















































Query Sequence  QTLHLANQGYTMNEIGDMIKLPPALANNWASRGYYGSVSHNARAVYNF
Query Conservation 



 

 
 
  

   
 

  

     
 




   




  
Alig confidence 






















............












Template Conservation   

   
 
 
  


  
 

 ............ 

      
  
Template Sequence  TLLGLLSEGLTNKQIADRXFLAE. . . . . . . . . . . . KTVKNYVSRLLAK
Template Known Secondary structure  TTT

T

............
Template Predicted Secondary structure 






............
Template SS confidence 















































   156...160.........170........ .180.........190.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions