Return to main results Retrieve Phyre Job Id

Job DescriptionP32717
Confidence64.02%DateThu Jan 5 11:50:40 GMT 2012
Rank164Aligned Residues37
% Identity30%Templatec1h0mD_
PDB info PDB header:transcription/dnaChain: D: PDB Molecule:transcriptional activator protein trar; PDBTitle: three-dimensional structure of the quorum sensing protein2 trar bound to its autoinducer and to its target dna
Resolution3.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   382.......390.........400.........410.........420.........430
Predicted Secondary structure 



















Query SS confidence 
















































Query Sequence  QTLHLANQGYTMNEIGDMIKLPPALANNWASRGYYGSVSHNARAVYNFY
Query Conservation 



 

 
 
  

   
 

  

     
 




   




  
Alig confidence 






















............













Template Conservation 


 


 
 
  


  
 

 ............ 

  
   
  

Template Sequence  TYLRWIAVGKTXEEIADVEGVKY. . . . . . . . . . . . NSVRVKLREAXKRF
Template Known Secondary structure  TTT

TT

............
Template Predicted Secondary structure 






............
Template SS confidence 
















































   180.........190.........200.. .......210......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions