Return to main results Retrieve Phyre Job Id

Job DescriptionP0AGD3
Confidence8.17%DateThu Jan 5 11:28:49 GMT 2012
Rank99Aligned Residues22
% Identity27%Templatec1q6xA_
PDB info PDB header:transferaseChain: A: PDB Molecule:choline o-acetyltransferase; PDBTitle: crystal structure of rat choline acetyltransferase
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10. ........20.....
Predicted Secondary structure 







.........






Query SS confidence 







. . . . . . . . .













Query Sequence  ELPALPYA. . . . . . . . . KDALAPHISAETIE
Query Conservation   

 


 .........   


 

   
 
Alig confidence 







.........













Template Conservation   

 



 
  

 


 
  

 
  
  
Template Sequence  DLPKLPVPPLQQTLATYLQCMQHLVPEEQFR
Template Known Secondary structure  TS






TTS
Template Predicted Secondary structure 











Template SS confidence 






























   22.......30.........40.........50..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions