Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAS9
Confidence2.09%DateThu Jan 5 11:13:44 GMT 2012
Rank100Aligned Residues23
% Identity22%Templatec3l8cA_
PDB info PDB header:ligaseChain: A: PDB Molecule:d-alanine--poly(phosphoribitol) ligase subunit 1; PDBTitle: structure of probable d-alanine--poly(phosphoribitol) ligase2 subunit-1 from streptococcus pyogenes
Resolution2.41 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40 .........50
Predicted Secondary structure 




.......


Query SS confidence 












. . . . . . .









Query Sequence  YVEHMRVNHPDQT. . . . . . . PMTYEEFFRE
Query Conservation 



 
  

   .......


 


 
 
Alig confidence 












.......









Template Conservation   
   
   

  

       

 

   
Template Sequence  SIEQFAQTQADFPVYDCLGERRTYGQLKRD
Template Known Secondary structure  STTSTT
Template Predicted Secondary structure 





Template SS confidence 





























   4.....10.........20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions