Return to main results Retrieve Phyre Job Id

Job DescriptionP25666
Confidence3.81%DateThu Jan 5 11:42:14 GMT 2012
Rank59Aligned Residues21
% Identity43%Templatec3fuyC_
PDB info PDB header:structural genomics, unknown functionChain: C: PDB Molecule:putative integron gene cassette protein; PDBTitle: structure from the mobile metagenome of cole harbour salt2 marsh: integron cassette protein hfx_cass1
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4..... 10.........20....
Predicted Secondary structure 

.........












Query SS confidence 





. . . . . . . . .














Query Sequence  STTIIT. . . . . . . . . AYFDIGRGDWTANKG
Query Conservation   




.........
 







     
Alig confidence 





.........














Template Conservation 





























Template Sequence  SPSLVTIRDFDNGQFAVLRIGRTGFPADKG
Template Known Secondary structure  TTTTTT
TTT




Template Predicted Secondary structure 
















Template SS confidence 





























   10.........20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions